PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG215700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 716aa    MW: 80795.3 Da    PI: 7.5201
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG215700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS346.44.5e-1063377071374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL++cA+avs ++++la+ +L+ ++++as +gd  qRla++++  L+ rla+++s+ly++l +++ +    ++ l++++l   ++P+
  Pavir.9NG215700.1.p 337 LRTLLIHCAQAVSVNNHTLASDILSIIRQHASTSGDDSQRLAFCLADCLEVRLAGTGSQLYHKLMAKRRN---AVDILKVFNLSIAICPF 423
                          6789**********************************************************99999988...9**************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          l+  +   N++I +  +g+ +vHiiDf+i  G+QWp+L+++La+R++gpp++RiTg+++p++g   +e+ ++ g+rLa++A+ ++++fe+
  Pavir.9NG215700.1.p 424 LRAPYYFSNKTIIDVSKGKPQVHIIDFGICFGFQWPSLFEQLAKREGGPPKVRITGIEQPQPGfrPNESSRNAGQRLADYASMFNISFEY 513
                          ****************************************************************9************************* PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          +  +++++e++++++++++++++l+Vn++++l++l de+vs++s+r++vL+++++++Pkv+++   + +++++ Fl+rf e +++ysalf
  Pavir.9NG215700.1.p 514 QG-ISSKWETIKIDDFNIEKDDVLIVNCIYRLKNLADETVSINSARNRVLNTIRTMKPKVFIHGVVNGSYSTPFFLTRFKEVMYHYSALF 602
                          **.7************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d ++++lpr++e+r+ +Er +  + + nv+aceg+er+er e+++kW+ r ++aGF+++pl+ +++k  +++++++++d +  +e++++l
  Pavir.9NG215700.1.p 603 DIIDKTLPRDDEARMILERDIYLPVVLNVIACEGSERIERPESYKKWKLRNKKAGFEQLPLNPDTVKGTRAMVKQYHKD-FVTNEDDQWL 691
                          *****************************************************************************77.********** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          +lgWk+r L+ +  W+
  Pavir.9NG215700.1.p 692 LLGWKGRILYGIATWK 707
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.597311688IPR005202Transcription factor GRAS
PfamPF035141.6E-103337707IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 716 aa     Download sequence    Send to blast
MANTPGCYAS SLKFMDPTNK YNDLDLLFHP TSSIDHFPPA ATTVNNDGYV ASSASSSSKI  60
HAPQSCEVSS NMTPDWYGTN VAEYSEESWI NSDITLKYIN KLLMQEDSDE KSKSHHGESA  120
LRAMEEPLYR LVGQNYPANT QLLPVCSCDH PNTLDGSISK FNGPSCSNCP AAISSGNNHY  180
NHNLQAFEAP WRLSDIVGET RQFTQDTYTT ELGLNVGGLA IVENNSRYNQ SLQFNVGVSR  240
KHAEAQCRKM NSHKEDLDLL EGRSNKQFAT SFNEPTRDEI FDKVLLCFEH EPVDQGIVLQ  300
KAMSSRSTIN SQTDQGRTSA QRNKKGKKQQ RKEMMDLRTL LIHCAQAVSV NNHTLASDIL  360
SIIRQHASTS GDDSQRLAFC LADCLEVRLA GTGSQLYHKL MAKRRNAVDI LKVFNLSIAI  420
CPFLRAPYYF SNKTIIDVSK GKPQVHIIDF GICFGFQWPS LFEQLAKREG GPPKVRITGI  480
EQPQPGFRPN ESSRNAGQRL ADYASMFNIS FEYQGISSKW ETIKIDDFNI EKDDVLIVNC  540
IYRLKNLADE TVSINSARNR VLNTIRTMKP KVFIHGVVNG SYSTPFFLTR FKEVMYHYSA  600
LFDIIDKTLP RDDEARMILE RDIYLPVVLN VIACEGSERI ERPESYKKWK LRNKKAGFEQ  660
LPLNPDTVKG TRAMVKQYHK DFVTNEDDQW LLLGWKGRIL YGIATWKPCE SNNGD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-443417078375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466849.10.0hypothetical protein SORBIDRAFT_01g015170
TrEMBLK4ALU30.0K4ALU3_SETIT; Uncharacterized protein
STRINGSi039877m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-146GRAS family protein